PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00099364001
Common NameGSBRNA2T00099364001, GSBRNA2T00149933001, LOC106449828
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 309aa    MW: 34410.8 Da    PI: 4.5709
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00099364001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.68.8e-4351041100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrrkC+++Cv+apyfp +qp+kf +vhk+FGasnv+k+l++lp+  reda++sl+yeAear+rdP+yG+vg+i+ lqq l++ 
  GSBRNA2T00099364001   5 PCAACKLLRRKCTQECVFAPYFPPTQPQKFIYVHKVFGASNVTKILNDLPPPSREDAVNSLYYEAEARIRDPIYGCVGLISFLQQCLKKI 94 
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +++l+++kee
  GSBRNA2T00099364001  95 QQDLVTAKEE 104
                          *****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381554.0E-1072306IPR017414LOB domain-containing protein 10/36/41
PROSITE profilePS5089126.6914105IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-415102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MASTPCAACK LLRRKCTQEC VFAPYFPPTQ PQKFIYVHKV FGASNVTKIL NDLPPPSRED  60
AVNSLYYEAE ARIRDPIYGC VGLISFLQQC LKKIQQDLVT AKEELAGYIG PDAVNPQQPY  120
LPPLANNPPP NFMMAMEGMP HGVVPQGEPL IMREPNMPQH QHQPQDEQMQ LMGTDAHRMA  180
AMILERGDQQ GMFNGYGIDN NGSVTATGFN QMDVNDHTSG GSMSGPSLAL GSFGDAYQMG  240
HETEHHISHD QLQTQLMLQP PLQEGQEQNE GQFLMQPMGQ ENLHEEEDEE ELEPPVKWRK  300
SESKEASY*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00099364001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738350.0AB473835.1 Arabidopsis thaliana ASL2 mRNA for ASYMMETRIC LEAVES2-like 2 protein, complete cds.
GenBankAC0030400.0AC003040.3 Arabidopsis thaliana chromosome 2 clone F26B6 map CIC06C07, complete sequence.
GenBankAC0044820.0AC004482.3 Arabidopsis thaliana chromosome 2 clone F27L4 map CIC06C07, complete sequence.
GenBankCP0026850.0CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009140479.10.0PREDICTED: LOB domain-containing protein 10
RefseqXP_009140480.10.0PREDICTED: LOB domain-containing protein 10
RefseqXP_009140481.10.0PREDICTED: LOB domain-containing protein 10
RefseqXP_009140482.10.0PREDICTED: LOB domain-containing protein 10
RefseqXP_013634802.10.0PREDICTED: LOB domain-containing protein 10
RefseqXP_013746972.10.0PREDICTED: LOB domain-containing protein 10-like
SwissprotO648361e-177LBD10_ARATH; LOB domain-containing protein 10
TrEMBLA0A078DKA40.0A0A078DKA4_BRANA; BnaA07g21600D protein
TrEMBLA0A0D3C1I70.0A0A0D3C1I7_BRAOL; Uncharacterized protein
TrEMBLM4ETM10.0M4ETM1_BRARP; Uncharacterized protein
STRINGBra032153.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM149081720
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23660.21e-154LOB domain-containing protein 10
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]